PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01020.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 288aa    MW: 33157.6 Da    PI: 6.9894
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01020.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-141462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W++eEd +l+ +++  G+g +W + ++++g++R++k+c++rw++yl
  Rsa1.0_01020.1_g00009.1 14 KGPWSPEEDAKLKSYIETSGTGgNWIALPHKIGLKRCGKSCRLRWLNYL 62
                             79*********************************************97 PP

2Myb_DNA-binding383.8e-1269111246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g +++eE+ ++ ++    G++ W+ Ia+ ++ gRt++++k++w++
  Rsa1.0_01020.1_g00009.1  69 GGFSEEEENIICNLYLTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                              569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.464962IPR017930Myb domain
SuperFamilySSF466891.56E-2511109IPR009057Homeodomain-like
SMARTSM007171.9E-111364IPR001005SANT/Myb domain
PfamPF002498.0E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-231569IPR009057Homeodomain-like
CDDcd001671.48E-71662No hitNo description
PROSITE profilePS5129420.54663117IPR017930Myb domain
SMARTSM007178.1E-1167115IPR001005SANT/Myb domain
PfamPF002497.2E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2370118IPR009057Homeodomain-like
CDDcd001674.50E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGRAPCCDKT NVKKGPWSPE EDAKLKSYIE TSGTGGNWIA LPHKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEENIIC NLYLTIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLIIK  120
QRKELQEGCM EQQQMMVMMK RQQEQQQIQT TFTMRQDQTI FTWPLQQLPY HHHHDRVPNL  180
VMNSLGDQED IKPAITKNMA KIEDQELERT NALDHLSFSQ LLLDHNNNLG EGLSMNSILS  240
TNTSNNHQWF GNVIDEDIDL FSGATSTSAD QDTIRWEDIS SLVCPDSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195971e-168AY519597.1 Arabidopsis thaliana MYB transcription factor (At3g49690) mRNA, complete cds.
GenBankBT0292241e-168BT029224.1 Arabidopsis thaliana At3g49690 mRNA, complete cds.
GenBankY142091e-168Y14209.1 A.thaliana mRNA for AtMYB84 R2R3-MYB transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603272.11e-176PREDICTED: transcription factor RAX3
SwissprotQ9M2Y91e-154RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0D3DRN61e-176A0A0D3DRN6_BRAOL; Uncharacterized protein
STRINGBra017963.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29412568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.11e-137myb domain protein 84